Y

YouLibs

Remove Touch Overlay

What's the BEST JUICER? 🍊Top 2 Cold-Pressed Picks 2021 Comparison 🌱 Save Money & Time!

Duration: 31:23Views: 35.2KLikes: 1.4KDate Created: Sep, 2021

Channel: FullyRawKristina

Category: People & Blogs

Tags: juicerecipesjuicingrecipescleaneatingnutmilkjuicer comparisonnamajuicermasticatingcentrifugalnama juicer reviewnamajuicerreviewdetoxnama review - 3 recipesgreenjuicerawfoodjuicerholidaysrawdietvegansvegetarianeatcookingslowjuicercoldpressedkitchenfullyrawkristinarawvegankristinafullyrawjuicecleansejuicerecipeveganvegancouplejuicingbestjuicerplantbasedtransformationlifestyleveganismnamaweightlosssorbethealthyfullyrawwhatiatetodayjuicerreview

Description: 🍉 Get 10% OFF the NEW J2 Nama Juicer by using the code: KRISTINAJ210 at checkout here: bit.ly/namaj2 Payment plans are available! 15-year warranty! 🌱 In this video I compare the new J2 Nama Juicer with the original Nama Vitality 5800. Both of these juicers are excellent. If you're looking to get a new juicer, I highly recommend either of these Nama juicers. They surpass other juicers in yield, quality, sound, time, cleaning, pulp, and more! 🍍Get the Original Vitality 5800 Nama Juicer 10% off by using the code: JUICELIFE at checkout here: bit.ly/namasale 🍊Additional Nama Juicer Comparison Video Here: youtu.be/nPcDlHiWLfY & Honest Review Here: youtu.be/FgpK4J98L4s 🍒 Download my FullyRaw recipe app on iTunes here: itunes.apple.com/us/app/fullyraw-by-kristina/id1351412313?mt=8 🍓 Download my recipe app on Android here: play.google.com/store/apps/details?id=com.frm.fullyraw 🍊 Get the Vitamix Ascent 3500 blender here: kqzyfj.com/click-8479771-13531953 🥝 Get $100 OFF the V1200 Reconditioned Vitamix blender here: jdoqocy.com/click-8479771-13851331 🫐 Accessories for the Ascent Series blender: tkqlhce.com/click-8479771-14398918 🌺 Please follow my Instagram here at instagram.com/fullyrawkristina 🌱 Get 30% off Sunwarrior's Plant-Based Protein, Supplements, and Magnesium: bit.ly/sunwarriorhealthbundle 🌱 Get the best quality organic and non-GMO gardening seeds from True Leaf Market here: bit.ly/trueleafgardenseeds 🌱 Microgreens Beginner's Growing Kit: bit.ly/microgreenbeginnerskit 🌱 Soil Microgreens Beginner's Kit: bit.ly/soilmicrogreenskit 🌱 How to grow sprouts for 25 cents a day video: youtu.be/qynti1u9ywE 🌱 Sprouting Seeds I LOVE (12 lb. Bulk Set): bit.ly/trueleafsprouts 🌱 Easy Sprouting Starter Kit (Jars Included): bit.ly/sproutingstarterkit 🌱 More Sprouting Jars: amzn.to/37vEqvQ 💧If you're interested in a Clearlight Sauna, please email info@healwithheat.com and let them know Kristina sent you. It's an infrared sauna with full-spectrum light therapy...and it's amazing! 🍇 Join my Inner Circle community here and get access to our private bi-weekly Zoom calls: challenge.fullyraw.com/coaching 🥒 Subscribe to my email newsletter & Download my FREE e-Book: A Beginner's Guide to Juicing... lp.constantcontactpages.com/su/r1Da2OL/fullyrawjuicingebook 🍉 Join my 21-Day FullyRaw & Vegan Challenge here: challenge.fullyraw.com/2020 🥥 Dehydrators I love: bit.ly/bestexcaliburdehydrators 🍍 Download your FREE e-Book on 5 Ways to Go Raw Vegan here: giveaway.fullyraw.com 💧 Get $100 off an AquaTru Water Purification System: bit.ly/aquatrufullyraw 💧 Get 50% off the Air Doctor Purifier Here: bit.ly/airdoctorhome 📚 Buy my published book: tinyurl.com/fullyrawbook 🛍️ Check out my online store: fullyraw.com/shop ☀️ My website & online programs here: fullyraw.com Follow Me: Subscribe: bit.ly/FRKsub Follow my FB: facebook.com/FullyRawKristina Follow My Instagram: instagram.com/fullyrawkristina Twitter: twitter.com/FullyRaw Pinterest: pinterest.com/fullyraw Tik Tok: @fullyrawkristina Follow My Other Channels: RawfullyOrganic: youtube.com/user/RawfullyOrganic FullyRaw en Español: youtube.com/channel/UCPrwOVtj-wp4h1VMB4nNZmQ Official Website: fullyraw.com About FullyRawKristina: Kristina Carrillo-Bucaram lives to inspire a FullyRaw, or 100% raw vegan healthy vegan lifestyle at fullyraw.com. A raw vegan lifestyle incorporates fruits, vegetables, nuts, and seeds. KristinaFullyRaw posts new videos every week that include recipes, tips, tricks, vlogs, motivation, fitness, exercise, and inspiration on how to be the best version of yourself! Disclaimer: I am not a doctor. Please always consult with your medical practitioner for your own health needs and requirements. --------------------- Time Codes: 0:00 Intro 0:20 The New J2 vs. Original Vitality 5800 1:20 Which juicer is the best for you? 4:00 Importance of having a good juicer 6:00 Basic differences & capabilities between each juicer 14:00 Juicing & comparing PINEAPPLE 16:00 Juicing & comparing CARROTS 20:00 Juicing & comparing CELERY 25:00 The results 30:00 Outro #vegan #juicing #recipes #juicer #healthy

Swipe Gestures On Overlay