Y

YouLibs

Remove Touch Overlay

Get the Glow! 🍓 Best Juicing Recipe for Healthy Skin, Hair, & Nails + Easy Bonus Mocktail Recipe 🍍🍹

Duration: 07:17Views: 35.3KLikes: 2.1KDate Created: Apr, 2022

Channel: FullyRawKristina

Category: People & Blogs

Tags: cleaneatingcouplesmoothiesjuicingrecipedetoxjuicerhealingfitnessveganrecipesrecipesgamechangersjuicingforweightlossvegancouplearthritisweightlosswhatiatetodaybreakfastjuicerecipesjuicingrecipesexercisecleansegreenjuicesummerrawfoodrawdietveganshoustonvegetarianeatdietcookingkitchenfullyrawkristinarawveganhowtogovegankristinafullyrawhealthjuicerecipevegantransformationjuicingbestjuicerplantbasedjuicelifestyleveganismhealthyrecipeshealthyfullyraw

Description: 🍊 Get $55 off the J2 Nama Juicer using the code: FULLYRAW55 at checkout here: bit.ly/namaj2 Payment plans are available with a 15-year warranty! 🌺 Please follow my Instagram here at instagram.com/fullyrawkristina 🍒 Download my FullyRaw recipe app on iTunes here: itunes.apple.com/us/app/fullyraw-by-kristina/id1351412313?mt=8 🍓 Download my recipe app on Android here: play.google.com/store/apps/details?id=com.frm.fullyraw 🌱 Get 30% off Sunwarrior's Plant-Based Protein, Supplements, and Magnesium: bit.ly/sunwarriorhealthbundle 🎁 Vitamix SALES here: jdoqocy.com/click-8479771-15102555 🍊 Get the Vitamix Blender Ascent 3500 blender $75 off: kqzyfj.com/click-8479771-13531953 🥝 Get $100 OFF the V1200 Reconditioned Vitamix blender here: jdoqocy.com/click-8479771-13851331 🫐 Accessories for the Ascent Series blender: tkqlhce.com/click-8479771-14398918 💧 Get $150 off an AquaTru Water Purification System: bit.ly/aquatrufullyraw 🌱 STOCK UP on the best quality organic and non-GMO gardening seeds from True Leaf Market here: bit.ly/trueleafgardenseeds 🌱 Sprouting Seeds I LOVE (12 lb. Bulk Set): bit.ly/trueleafsprouts 🌱 Easy Sprouting Starter Kit (Jars Included): bit.ly/sproutingstarterkit 🌱 More Sprouting Jars: amzn.to/37vEqvQ 🌱 Microgreens Beginner's Growing Kit: bit.ly/microgreenbeginnerskit 🌱 Soil Microgreens Beginner's Kit: bit.ly/soilmicrogreenskit 🌱 How to grow sprouts for 25 cents a day video: youtu.be/qynti1u9ywE 💧If you're interested in a Clearlight Sauna, please email info@healwithheat.com and let them know Kristina sent you. It's an infrared sauna with full-spectrum light therapy...and it's amazing! 🍊 Kauai Farmacy plant-medicine remedies grown here in Hawaii: bit.ly/kauaifarmacy (use code: FULLYRAW for discount) 🍇 Join my Inner Circle community here and get access to our private bi-weekly Zoom calls: challenge.fullyraw.com/coaching 🥒 Subscribe to my email newsletter & Download my FREE e-Book: A Beginner's Guide to Juicing... lp.constantcontactpages.com/su/r1Da2OL/fullyrawjuicingebook 🍉 Join my 21-Day FullyRaw & Vegan Challenge here: challenge.fullyraw.com/2020 🥥 Dehydrators I love: bit.ly/bestexcaliburdehydrators. Get 20% off an Excalibur dehydrator using the code: FULLYRAW20. 🍍 Download your FREE e-Book on 5 Ways to Go Raw Vegan here: giveaway.fullyraw.com 💧 Get 50% off the Air Doctor Purifier Here: bit.ly/airdoctorhome 📚 Buy my published book: tinyurl.com/fullyrawbook 🛍️ Check out my online store: fullyraw.com/shop ☀️ My website & online programs here: fullyraw.com Follow Me: Subscribe: bit.ly/FRKsub Follow my FB: facebook.com/FullyRawKristina Follow My Instagram: instagram.com/fullyrawkristina Twitter: twitter.com/FullyRaw Pinterest: pinterest.com/fullyraw Tik Tok: @fullyrawkristina Follow My Other Channels: RawfullyOrganic: youtube.com/user/RawfullyOrganic FullyRaw en Español: youtube.com/channel/UCPrwOVtj-wp4h1VMB4nNZmQ Official Website: fullyraw.com About FullyRawKristina: Kristina Carrillo-Bucaram lives to inspire a FullyRaw, or 100% raw vegan healthy vegan lifestyle at fullyraw.com. A raw vegan lifestyle incorporates fruits, vegetables, nuts, and seeds. KristinaFullyRaw posts new videos every week that include recipes, tips, tricks, vlogs, motivation, fitness, exercise, and inspiration on how to be the best version of yourself! Disclaimer: I am not a doctor. Please always consult with your medical practitioner for your own health needs and requirements. --------------------- Time Codes: 0:00 Intro 0:10 Best Juicing Recipe for Energy, Skin, Hair, & Nails... 1:30 Juicing 3:00 Best Slow Cold-Pressed Juicer 4:00 Get the Glow! Try this recipe... 5:00 Basic Mocktail Recipe 6:30 Outro #juicing #recipes #vegan #weightloss #glow

Swipe Gestures On Overlay