Y

YouLibs

Remove Touch Overlay

The Fortress of Dr. Radiaki - Vertigo Machine

Duration: 24:52Views: 350.3KLikes: 17.1KDate Created: Jan, 2022

Channel: Civvie 11

Category: Gaming

Tags: the fortress of dr. radiakiretro gameradiakireviewfpsrecapcivvie11radakaicv11civvie's dungeon

Description: Anti-humor meets anti-game design. Chapters: 00:00 - Intro 01:00 - The Sketch™ 02:08 - A Joke Game 04:29 - Your Brain Hurts 06:55 - There is No Strafing 09:27 - Every Gun is the Doom 3 Shotgun 11:51 - Artificial Whatever 17:52 - Vertigo Patrons see episodes early: patreon.com/civvie11 Twitter: twitter.com/civvie11 Join the Dungeon discord: discord.gg/nwArDS2yEH Noelle's channel - youtube.com/channel/UCShccf0NLU7E3USx82Vu2jQ #GameReview #DOS #FreeCivvie

Swipe Gestures On Overlay
Home
Channels
All Videos
Categories
Tags
Related
Infinite Masonry

Related

Sorts:
▼
Filters:
CategoryChannelDate CreatedDurationLikesPopularityTagsTitleViews
▼
1-10mins10-30mins30mins+past weekpast monthpast year2020-20232014-2019
  • The Hedon Duology - Crystalpunk UltraviolenceCivvie 1126:17Sep, 2021509.2Kbackgroundvideo thumbnail for: The Hedon Duology - Crystalpunk Ultraviolence
  • Cruelty Squad is Wonderful and DepravedCivvie 1131:05Jul, 2021897Kbackgroundvideo thumbnail for: Cruelty Squad is Wonderful and Depraved
  • Redneck Rampage Deelucks SpecialCivvie 1147:55Apr, 20211.2Mbackgroundvideo thumbnail for: Redneck Rampage Deelucks Special
  • You Are Empty - The Stalingrad Chicken EmergencyCivvie 1126:35Jul, 2020850.3Kbackgroundvideo thumbnail for: You Are Empty - The Stalingrad Chicken Emergency
  • Half-Life: Opposing Force/Blue Shift - Enter the GreaseCivvie 1135:07Sep, 2021717Kbackgroundvideo thumbnail for: Half-Life: Opposing Force/Blue Shift - Enter the Grease
  • EXTREME Rise of the Triad - You Do Not Belong HereCivvie 1128:59May, 2021569.7Kbackgroundvideo thumbnail for: EXTREME Rise of the Triad - You Do Not Belong Here
  • Alpha Prime - Smoothbrain CriminalCivvie 1136:06Feb, 2021557.3Kbackgroundvideo thumbnail for: Alpha Prime - Smoothbrain Criminal
  • Half-Life - A Linear Sequence of ScaresCivvie 1158:29Jan, 20211.9Mbackgroundvideo thumbnail for: Half-Life - A Linear Sequence of Scares
  • The Varginha Incident - Vicious CyclesCivvie 1124:52Sep, 2020511.5Kbackgroundvideo thumbnail for: The Varginha Incident - Vicious Cycles
  • PRO BLOOD - DEATH WISHCivvie 1134:05Oct, 2020853.4Kbackgroundvideo thumbnail for: PRO BLOOD - DEATH WISH
    • Items shown
    to: 10
    of:999
    ‹123...100›