
Channel: Lessons from the Screenplay
Category: Film & Animation
Tags: how tostorytellingbasicsvideofilmmakingscreenplaytipssettingcharactervideo essaywritinglessons from the screenplaymichael tuckerscreenwritingscreenwriterscreenwriting techniquesxmenwriting tipsscriptstructurefilmmakerx-menscreenwriting tipsessayfirst classlocation
Description: Start your 2 month free trial of Skillshare by going to skl.sh/lfts17 The One X-Cellent Scene playlist: youtube.com/playlist?list=PLd7v7nQLQGwLFOPGk1QPEBJr6D9F2yUnq X-Men: First Class thoughtfully utilizes the setting of its midpoint sequence, Sebastian Shaw’s attack on Division X, to heighten the scene’s emotional impact on the audience. In this video, the LFTS team breaks down the design of the young mutant’s archetypal “warm house”, the roles it helps establish, and why the scene feels so dramatic as that sense of safety is stripped away. Support this channel at: patreon.com/LFTScreenplay Like LFTS on Facebook: facebook.com/lessonsfromthescreenplay Follow me at: twitter.com/michaeltuckerla LFTS Merch: standard.tv/collections/lfts Video Produced by: Michael Tucker (twitter.com/michaeltuckerla) Written by: - Tricia Aurand (twitter.com/TriciaJeanA) - Brian Bitner (twitter.com/BrianBitner) - Alex Calleros (twitter.com/alex_calleros) - Michael Tucker Edited by: Alex Calleros Become a channel member here on YouTube: youtube.com/channel/UCErSSa3CaP_GJxmFpdjG9Jw/join Check out my kit, from screenwriting books to gear: kit.co/LFTS/screenwriting-books LFTS Recommended Reading List: lessonsfromthescreenplay.com/reading-list Translate this video: Thanks to Diego Rojas for composing original music for this video. Check out more of his work: soundcloud.com/diegorojasguitar TwinSmart's Marxist Arrow is licensed under a Creative Commons Attribution license (creativecommons.org/licenses/by/4.0/) Artist: twinmusicom.org With the company Twin musicom licensed under the Creative Commons license Attribution (creativecommons.org/licenses/by/4.0/) Artist: twinmusicom.org #OneXCellentScene



















