Y

YouLibs

Remove Touch Overlay

How Cats Built the Pyramids

Duration: 02:20Views: 314.1KLikes: 10.9KDate Created: May, 2016

Channel: brain4breakfast

Category: Education

Tags: egyptologyeducationegyptmonumentsancient warfareguns germs and steelnilewarancient egypthistorypyramidsancientcatscatwarfarezeihan

Description: patreon.com/brain4breakfast Album of images: imgur.com/a/B2dg0 Script: pastebin.com/1cuvEr1a All media is Creative Commons, public domain, my own work or fair use. "Mister Exposition" Kevin MacLeod (incompetech.com) Licensed under Creative Commons: By Attribution 3.0 License creativecommons.org/licenses/by/3.0 youtube.com/channel/UCUoW72_1nRhkUM0EavUBgYg

Swipe Gestures On Overlay
Home
Channels
All Videos
Categories
Tags
Related
Infinite Masonry

Related

Sorts:
▼
Filters:
CategoryChannelDate CreatedDurationLikesPopularityTagsTitleViews
▼
1-10mins10-30mins30mins+past weekpast monthpast year2022-20252016-2021
  • The Sea Peoples & The Late Bronze Age Collapse // Ancient History Documentary (1200-1150 BC)History Time02:29:02Sep, 202012.7Mbackgroundvideo thumbnail for: The Sea Peoples & The Late Bronze Age Collapse // Ancient History Documentary (1200-1150 BC)
  • 4500 Years Old Hidden Room Found in EgyptZem TV15:25Apr, 20221.3Mbackgroundvideo thumbnail for: 4500 Years Old Hidden Room Found in Egypt
  • Great Pyramids & Atlantis on 7,000 YEAR Ancient Relic? Ancient Egypt is FAR Older Than They Say...Bright Insight17:13Aug, 2021773.5Kbackgroundvideo thumbnail for: Great Pyramids & Atlantis on 7,000 YEAR Ancient Relic? Ancient Egypt is FAR Older Than They Say...
  • How Egyptians Made Right Angles #shortsVsauce200:26Sep, 20214.6Mbackgroundvideo thumbnail for: How Egyptians Made Right Angles #shorts
  • Rare Footage from Egypt - Ancient Machined Artifacts found deep beneath the Step Pyramid!UnchartedX45:03Jan, 2022715.4Kbackgroundvideo thumbnail for: Rare Footage from Egypt - Ancient Machined Artifacts found deep beneath the Step Pyramid!
  • The MOST precisely made granite object of Ancient Egypt - and why it's NOT geopolymer!UnchartedX35:11Jan, 2021858.9Kbackgroundvideo thumbnail for: The MOST precisely made granite object of Ancient Egypt - and why it's NOT geopolymer!
  • Units of History - Nubian Archers - Longbowmen of Africa DOCUMENTARYInvicta23:18Oct, 2021576.2Kbackgroundvideo thumbnail for: Units of History - Nubian Archers - Longbowmen of Africa DOCUMENTARY
  • Punic Wars from the Carthaginian Perspective | Animated HistoryThe Armchair Historian27:54May, 20211Mbackgroundvideo thumbnail for: Punic Wars from the Carthaginian Perspective | Animated History
  • Ancient Egypt के लोग दिमाग को नाक से क्यों निकालते थे? [ Hindi ]Tech & Myths09:22Mar, 2022581Kbackgroundvideo thumbnail for: Ancient Egypt के लोग दिमाग को नाक से क्यों निकालते थे? [ Hindi ]
  • Pyramids Are Not What You Think They Are: Underground Halls Beneath ThemUniverse Inside You31:25Jul, 20202Mbackgroundvideo thumbnail for: Pyramids Are Not What You Think They Are: Underground Halls Beneath Them
    • Items shown
    to: 10
    of:999
    ‹123...100›