Channel: Hollywood Graveyard
Category: Entertainment
Tags: londonbroadwaycryptdraculagraveyard tourthe beatlestheaterarthur darkmemorialwest endstar warscemeteryfrankensteinenglandchurchyardbram stokergravetombalec guinnesscemetery tourhollywood tourhollywood cemeterycatacombsgolders greencrematoriumobi wan kenobimausoleumtitanichighgatebritish authorscolumbarium
Description: Welcome to Hollywood Graveyard. Today, I turn the camera over to you, the Hollywood Graveyard Community, as we travel the world to visit famous and historical graves in your neck of the woods. Together we’ll cross the country, and the oceans, to pay our respects to legends around the globe, like Bram Stoker, Amy Winehouse, Alec Guinness, and many more. Full list of stars visited today: Arthur Shields, Michael Collins, Thomas Andrews, Wallace Hartley, Frederick Fleet, Benny Hill, Alec Guinness, Florence Nightingale, Arthur Conan Doyle, Lewis Carroll, Eleanor Rigby, Stuart Sutcliffe, George Formby, Anne Bronte, Little John, John Ray, Ebenezer Scrooge, Diana Dors, Alan Lake, George Orwell, Dusty Springfield, Robin Gibb, Andy Gibb, Agatha Christie, John Mills, Roald Dahl, William Penn, Brian Jones, Karl Marx, Douglas Adams, Corin Redgrave, George Eliot, Malcolm McLaren, Patrick Caulfield, Ralph Richardson, Edith Evans, Ellen Terry, Thomas Arne, Michael Redgrave, Alan Jay Lerner, Anna Neagle, Margaret Rutherford, Boris Karloff, Gracie Fields, Hattie Jacques, Charlie Chaplin, Noel Coward, Peter O'Toole, Richard Beckinsale, VIvien Leigh, Marc Bolan, Keith Moon, David Gest, Larry Adler, Hughie Green, Robert Harbin, Ivor Novello, Peter Sellers, Anna Pavlova, Ella Shields, Bram Stoker, Karl Mannheim, Sigmund Freud, Amy Winehouse. All the footage in this video comes courtesy of you, the Hollywood Graveyard community. A big THANK YOU to all who submitted! Viewers Special Playlist: youtube.com/watch?v=vYGWzC7pG9Q&list=PLIBayBl3YfsVBF51oMDXWGrs3azJh9-Zi Intro footage courtesy of: Grace, Ashley & Jason, Frederik-Lennart Borgholte, Ben Conroy, Paul Wintle, Virgilio Rodriguez, Gregory Frank, Bengt Fredlund, Brandie & Michael Hurst, Frederic Le Saux, and Richard Brown. Thanks to our Patreon supporters, who help make these videos possible: Janet Elliot, Michele Kotick, Sean Leeds, Shawndelle Young,Trish McFerran, Bruce Murdock, Victoria Waldock, Charles Whelan, Marcos M, Scott DeVane, Danielle Tripodi, Deb Blissick, Don Bass, Darrell Lee, Eve Devinsky, Jett, Matthew Periolat, Jennifer Hall, Vanessa Torres, Stuart Chastain, Shannon Mead, Steve Stalzle, Maria Elena Gonzalez, Kim Friberg, Mike Moore, Mandy S, Blake Changnon, Ricardo Sanchez, Michael Foat, Rachel Gipson, Lynn Eades, Bree B, Michael Bawden, Jim, Kathy Sandberg, Roger Beard, Warren Butler, NWOZ007, Henry Vinson, Matthew Henricksen, Roger Maves, and Jason Young. Support Us on Patreon: patreon.com/hollywoodgraveyard Arthur's Book ZOMBIE JUNIOR: amazon.com/dp/0999459104 Written & Produced by Arthur Dark Music by Giuseppe Vasapolli Additional Music by Arthur Dark "Somebody's Wrong" by Isham Jones Disclaimer: Tour videos are independently produced, and are not endorsed by the respective cemetery. When visiting a cemetery, do so only during regular visiting hours, take only pictures, and leave only approved grave offerings. Be courteous and respectful of both the living and the dead. In deference to families of those profiled herein, any requests to remove profiles by family members of the individual will be honored. Profile images courtesy of: Wikimedia Commons, public domain searches, and fair use promotional material. Copyright: Short excerpts of media featured in this video are copyright of their respective owners, and are used herein for commentary and reference under "fair use." Please contact us with any copyright concerns if you feel the use of your property does not meet the conditions of "fair use," we'll be happy to comply. Famous Grave Tour videos copyright Hollywood Graveyard. Music copyright Giuseppe Vasapolli & Arthur Dark.