Y

YouLibs

Remove Touch Overlay

Don't Use Telegram. Don't Use Telegram. Don't Use Telegram. Don't Use Telegram. Don't Use Telegram.

Duration: 09:10Views: 94.6KLikes: 4.4KDate Created: May, 2021

Channel: Luke Smith

Category: Science & Technology

Tags: serversoftwarefacebookchanneltelegramprivacysynapsesecurematrixxmppplatformgnusecuritytwitterencryptionopen soucemessengerinstalllinuxwhatappsmstextfreesignal

Description: See title for description. Matrix FAQ: matrix.org/faq Element is the main program/"app" that accesses Matrix: element.io/get-started Matrix servers: anchel.nl/matrix-publiclist My website: lukesmith.xyz Please donate: donate.lukesmith.xyz Get all my videos off YouTube: videos.lukesmith.xyz or Odysee: odysee.com/$/invite/@Luke:7 BTC: bc1qw5w6pxsk3aj324tmqrhhpmpfprxcfxe6qhetuv XMR: 48jewbtxe4jU3MnzJFjTs3gVFWh2nRrAMWdUuUd7Ubo375LL4SjLTnMRKBrXburvEh38QSNLrJy3EateykVCypnm6gcT9bh OR affiliate links to things l use: vultr.com/?ref=8384069-6G Get a VPS and host a website or server for anything else. epik.com/?affid=we2ro7sa6 Get a cheap and reliable domain name with Epik. brave.com/luk005 Get the Brave browser. odysee.com/$/invite/@Luke:7 View my videos on Odysee and get a bonus for joining. coinex.com/register?refer_code=ndf87 Get crypto-rich on Coinex. Get reduced exchange fees for 3 months. coinbase.com/join/smith_5to1 Get crypto-rich on Coinbase. We both get $10 in Bitcoin when you buy or sell $100 in cryptocurrencies.

Swipe Gestures On Overlay