Y

YouLibs

Remove Touch Overlay

DIGESTION & VACUUM Discussion Feat. @VigorousSteve

Duration: 21:06Views: 4.6KLikes: 245Date Created: May, 2022

Channel: VintageGenetics

Category: Sports

Tags: shouldersfranktricepswesleyvissersstrengthphysiquebackstay goldenapparelwesleyoutschwarzeneggerstretchgeneticshamstringsstaygoldenmusclegoldeneragoldenworkingcontractionpowernattybicepsvintage geneticsclassicphysiquechestclassic physiquequadsgolden eravintagegeneticsnaturalvisserszanearnoldfoodvgnutritionclassicworkoutvintagegymclothingbodybuildinggear

Description: Timestamps 00:00 - Is Classic Physique Healthier Than Open Bodybuilding? 01:52 - Doing Vacuums Year-Round 05:12 - Digestion Discussion; Avoiding FODMAP Foods 09:13 - Apple Cider Vinegar 13:13 - The Downsides Of Digestive Enzyme Supplements 16:12 - "Supplementing" With Digestive Enzyme-Rich Foods 17:41 - Calorie-Dense Foods During The Offseason @VigorousSteve Social Media Website: vigoroussteve.com YouTube Channel: youtube.com/user/VigorousSteve Instagram: instagram.com/vigoroussteve TikTok: tiktok.com/@vigoroussteve Spotify: open.spotify.com/show/2wR0XWY00qLq9K7tlvJ000 📧 My private e-mail list for exclusive content regarding bodybuilding, nutrition, training, exclusive sales & more: bit.ly/VGMailList ----------------- 🛒VintageGenetics.com (Classic Gym Wear, Workout & Nutrition plans) discount code "VINTAGE" for 10% off your entire order. 💥The best performing and tasting supplements I use athlete.jackedfactory.com/WESLEY | "WESLEY" for 15% off your entire order. 🧴 The most effecive shampoo for hair loss prevention: bit.ly/ShampooToPreventHairLoss | "VINTAGE" for 15% off your entire order. Classic & Personalized Workout and Nutrition Plans? Contact me: Wesleyvissers@hotmail.com (Also for plant-based diets!) Instagram @WesleyVissers instagram.com/wesleyvissers @KaneVissers instagram.com/kanevissers Facebook facebook.com/VintageGenetics

Swipe Gestures On Overlay